DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and DPCoAC

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:252 Identity:66/252 - (26%)
Similarity:101/252 - (40%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TSVNCQ--SATPTSAPTSTAVVTPTLKDVAPRQLTRNHNIAAAAVAEGDSCEF------------ 69
            |.:|.|  :..|.|...|...:..|..:.....|.|.::...|.:....:.:|            
  Fly    96 TKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHV 160

  Fly    70 ---GSN---HYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRI-------SL 121
               |:|   ..||...|.||.|    .::..||||.:.|:.|...     :||:|.       ..
  Fly   161 DKDGTNTKGRRFLAGSLAGITS----QSLTYPLDLARARMAVTDR-----YTGYRTLRQVFTKIW 216

  Fly   122 AEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFA 186
            .|||.|.|.:|:..|.:|........|..||..|:.|.:.:|....   .|.:.||..|:|....
  Fly   217 VEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKP---NTLVSLAFGAAAGAAG 278

  Fly   187 DIALAPMEAAKVKIQT----TPGFAK--TLREALPKMTAQEGV-TAFYKGLVPLWMR 236
            ..|..|::..:.::||    |.|..:  |:.|.|.|:..:||| ..|||||...|::
  Fly   279 QTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 29/98 (30%)
Mito_carr <188..258 CDD:278578 19/56 (34%)
Mito_carr 273..350 CDD:278578
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 11/62 (18%)
Mito_carr 169..251 CDD:278578 26/90 (29%)
Mito_carr 279..356 CDD:278578 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.