DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Dic1

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:314 Identity:76/314 - (24%)
Similarity:117/314 - (37%) Gaps:74/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GGIISCGS---THTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLA--------EEGVRGLAKGWA 134
            ||:.|.|:   ||    ||||:|..||....         .:|:|        |:||.....|.:
  Fly    13 GGLASVGAAMVTH----PLDLIKVTLQTQQG---------HLSVAQLIPKLAREQGVLVFYNGLS 64

  Fly   135 PTFIGYSMQGLCKFGLYEVFKK-VYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKV 198
            .:.:........:||:||..|| |..|:.|.:.|....:||          ...|...|.:...|
  Fly    65 ASVLRQLTYSTARFGVYEAGKKYVNTDSFGGKVALAGASGL----------VGGIVGTPADMVNV 119

  Fly   199 KIQTTPGFAKTLR-------EALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLY 256
            ::|.........|       :.|.::..|||....:.|......|.|..|:.:.|.:::|  .:|
  Fly   120 RMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQT--KIY 182

  Fly   257 KYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGA---SALDVAK---Q 315
            ....|..:      :.||..|.|..:||.....::.|.|.:.::...||..   ...|:.|   :
  Fly   183 LLATPYFQ------DNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAK 241

  Fly   316 LGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPPPEMPESLKKKLG 369
            ||..|.:.|.||..|.:|..|...:       |||           |.|:.|.|
  Fly   242 LGPLGFFKGYVPAFVRLGPHTIITF-------VFL-----------EQLRLKFG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 26/90 (29%)
Mito_carr <188..258 CDD:278578 16/76 (21%)
Mito_carr 273..350 CDD:278578 22/82 (27%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 26/91 (29%)
PTZ00169 13..273 CDD:240302 73/308 (24%)
Mito_carr 89..184 CDD:278578 21/106 (20%)
Mito_carr 189..278 CDD:278578 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.