DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG16736

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:146 Identity:28/146 - (19%)
Similarity:56/146 - (38%) Gaps:25/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 ADIALAPMEAAKVKIQTTPGFAKTLREA------LPKMTAQEGVTAFYKGLVPLWMRQIPYTMMK 244
            |.:...|||..:|.:|     |..:..:      :.::.|:.|:..||.|:|...:|...:||..
  Fly    13 AQLLSHPMELVRVNMQ-----ANVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHTMST 72

  Fly   245 FACFERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASA 309
            :..|....:..|..::.........|   :..|..|.:|..|..:      .|:.:.:..:|:  
  Fly    73 YTLFYNLQDNKYVLMLQPYNTSMVLG---ITGFWGGVLATPFAKL------AVIRQADLTRGS-- 126

  Fly   310 LDVAKQLGWSGLWGGL 325
               .::..:...|.||
  Fly   127 ---YERRNYRNFWRGL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578
Mito_carr <188..258 CDD:278578 17/75 (23%)
Mito_carr 273..350 CDD:278578 9/53 (17%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 17/72 (24%)
Mito_carr 187..277 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.