DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG2616

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:331 Identity:66/331 - (19%)
Similarity:117/331 - (35%) Gaps:88/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 THTMVVPLDLVKCRL--QVDPA-------------------------------KYKSVFTGFRIS 120
            |...:.|||::|.|:  |..||                               ::.|.:......
  Fly   104 TACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKI 168

  Fly   121 LAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAI------GEENAFL--------YR 171
            ...||:..|..|..||.:......:..|..||.||..|....      .:|...|        ..
  Fly   169 SRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLP 233

  Fly   172 TGLYLAASASAEFFADIALAPMEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMR 236
            :.:.:.:..:|...|...::|:|..:.|:|........:.:.:..:.|.:||...::||.|..:|
  Fly   234 SVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILR 298

  Fly   237 QIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQ--LVVTFAAGYIAGVFCAIVSHPADTVVS 299
            .:|::.:.:..:|..            :.:...|.|  ..::|.||.:||...|||:.|.|.|.:
  Fly   299 DVPFSGIYWPIYESL------------KQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKT 351

  Fly   300 KLNQAKG-------ASALDVAKQLGWS------------GLWGGLVPRI--------VMIGTLTA 337
            ......|       :.|.|..|:..:|            ||:.|..||:        :||.|...
  Fly   352 HEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEY 416

  Fly   338 AQWFIY 343
            ::.|.:
  Fly   417 SKSFFF 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 22/103 (21%)
Mito_carr <188..258 CDD:278578 13/69 (19%)
Mito_carr 273..350 CDD:278578 25/98 (26%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 21/102 (21%)
Mito_carr 230..321 CDD:278578 15/102 (15%)
Mito_carr 321..425 CDD:278578 26/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.