DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Dic4

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:221 Identity:59/221 - (26%)
Similarity:92/221 - (41%) Gaps:34/221 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RQLTRNHNIAAAAVAEGDSCEFGSNHYFLLCGLGGII------SCGSTHTMVVPLDLVKCRLQVD 106
            ||:| :.||.......|...|:.....:    ||.||      :|||  ...:|.||:..|:|.|
  Fly    82 RQMT-STNIHFIVYDTGKKMEYVDRDSY----LGKIILGCVAGACGS--AFGIPTDLINVRMQTD 139

  Fly   107 ----PAK---YKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGE 164
                |.|   ||.||.|......|||.:.|.||.:......|:....:...|::.|......|..
  Fly   140 MKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISV 204

  Fly   165 ENA----FLYRTGLYLAASASAEFFADIALAPMEAAK-VKIQTTPGFAKTLREALPKMTAQEGVT 224
            .:.    ||...|..:.:||...        |::..: :.:.:.||..:|:.:|...| .:.||.
  Fly   205 NDGLPLHFLTSLGTSIISSAITH--------PLDVVRTIMMNSRPGEFRTVFQASVHM-MRFGVM 260

  Fly   225 AFYKGLVPLWMRQIPYTMMKFACFER 250
            ..|:|.||..:|:.|.|.:.|..:|:
  Fly   261 GPYRGFVPTIVRKAPATTLLFVLYEQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 29/101 (29%)
Mito_carr <188..258 CDD:278578 17/64 (27%)
Mito_carr 273..350 CDD:278578
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 59/221 (27%)
Mito_carr 26..100 CDD:278578 6/18 (33%)
Mito_carr 104..201 CDD:278578 29/102 (28%)
Mito_carr 211..292 CDD:278578 22/85 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.