DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG6893

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:212 Identity:51/212 - (24%)
Similarity:93/212 - (43%) Gaps:36/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EFGSNHY---------FLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPA-------KYKSVFTG 116
            |.|..|.         .|:..|.|.:: |...|   |::|:..|:||:.|       .|::||.|
  Fly    90 EMGKEHLDDPAGLLDKVLVAALAGCVA-GVVGT---PMELINTRMQVNRALPKETRWNYRNVFDG 150

  Fly   117 FRISLAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLY----RTGLYLA 177
            ......|||...|..|...:|:..|:..:.:...|:..|::|.:       |.:    .|.|:|.
  Fly   151 LYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAE-------FFHMKHDNTLLHLI 208

  Fly   178 ASASAEFFADIALAPMEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTM 242
            :|.:|.|.....:.|:|..:......   ::.|..::..| .:.|....::|:||..:|.:|.|:
  Fly   209 SSVTAAFVCGPIIKPIENLRYLRMVD---SRRLINSISYM-MRFGSRGPFRGMVPYVLRMVPNTV 269

  Fly   243 MKFACFERTLELLYKYV 259
            :.|..||: |.:.:.|:
  Fly   270 ITFLSFEQ-LRVNFGYI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 26/104 (25%)
Mito_carr <188..258 CDD:278578 15/69 (22%)
Mito_carr 273..350 CDD:278578
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 2/5 (40%)
Mito_carr 98..192 CDD:395101 24/97 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.