DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Bmcp

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:307 Identity:75/307 - (24%)
Similarity:123/307 - (40%) Gaps:54/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFR----------ISLAEEGVRGLAKGWAP 135
            ||:.|. :......|:|..|.|||:...|....|:..|          || .|||:|.|..|..|
  Fly    13 GGVASI-TAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKIS-REEGLRALYSGIWP 75

  Fly   136 TFIGYSMQGLCKFGLYEVFKKV---YGDAIGEENAFLYRTGLYLAASASAEFFADIALA-PMEAA 196
            ..:..:..|..|||.|...||:   .|..|.|:.:....:.:..||:|.|   ...|:| |.:..
  Fly    76 AVLRQATYGTIKFGTYYTLKKL
ANERGLLINEDGSERVWSNILCAAAAGA---ISSAIANPTDVL 137

  Fly   197 KVKIQT-TPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFE-RTLELLYKYV 259
            ||::|. ..|..|.|.....::...|||...::|:.|...|.:....::...:: ..|:|:..: 
  Fly   138 KVRMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNAF- 201

  Fly   260 VPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGAS---------------- 308
                      |:.:...|.:.:||.:..||.|.|.|.:.::|...:..|                
  Fly   202 ----------GDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLY 256

  Fly   309 --ALDVAKQL----GWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVF 349
              :||.|.|.    |...|:.|.:|..|.:|......:..|:.:|.:
  Fly   257 SGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 28/91 (31%)
Mito_carr <188..258 CDD:278578 17/72 (24%)
Mito_carr 273..350 CDD:278578 22/99 (22%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 27/85 (32%)
Mito_carr <132..199 CDD:278578 15/66 (23%)
Mito_carr 204..303 CDD:278578 22/98 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.