DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG18418

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:285 Identity:61/285 - (21%)
Similarity:119/285 - (41%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FLLCGLGGII-SCGSTHTMVVPLDLVKCRLQVD----PAKYKSVFTGFRISLAEEGVRGLAKGWA 134
            |::.|..|:: :|     :|.||||:|.|:|:.    ..:||:.|......|..||:..|..|.:
  Fly    18 FVMGGTSGMLATC-----IVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLS 77

  Fly   135 PTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVK 199
            ...:..:.....|.|:|::....|....|...:.:....:.:.|.|    |..:...|.|.|.::
  Fly    78 AGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGA----FGAMCGNPAEVALIR 138

  Fly   200 IQTTPGFA-------KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYK 257
            :.:.....       |.:.:|..::...|||.|.::|.:|...|.:...|::.|.:......|:.
  Fly   139 MMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLHG 203

  Fly   258 YVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAK-------GASALDVAKQ 315
            |:          .|.:.:...|..::|:..::.|.|.|...:::.|.|       .:..:||.|:
  Fly   204 YL----------SEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKK 258

  Fly   316 L----GWSGLWGGLVPRIVMIGTLT 336
            :    |...:|.|..|.::.:|..|
  Fly   259 VLKNEGAFAVWKGFTPYLMRMGPHT 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 24/89 (27%)
Mito_carr <188..258 CDD:278578 15/76 (20%)
Mito_carr 273..350 CDD:278578 16/75 (21%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 25/94 (27%)
PTZ00169 18..296 CDD:240302 61/285 (21%)
Mito_carr 109..205 CDD:278578 18/99 (18%)
Mito_carr 208..300 CDD:278578 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.