DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG7514

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:289 Identity:67/289 - (23%)
Similarity:112/289 - (38%) Gaps:38/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GLGGII-SCGSTHTMVVPLDLVKCRLQVD--PAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGY 140
            ||.|:: :|     :|.||||||.|:|:.  ..:|||.|.........||:..|..|.:...:..
  Fly    20 GLAGMLGTC-----IVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQ 79

  Fly   141 SMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPG 205
            :.....:.|.|::....|..........|...|:.:.|.|....|.:    |.|.|.:::.:...
  Fly    80 ATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGN----PAEVALIRMMSDNR 140

  Fly   206 FAKTLR-------EALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKP 263
            .....|       .|..::...|||...:||.:|...|.:...|::.|.:.:......:|.    
  Fly   141 LPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF---- 201

  Fly   264 RADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGAS-------ALDVAKQLGWSGL 321
                   ..|.:..||..::|:...|.|.|.|...:::.|.|.|.       .:.|:|..|.:.|
  Fly   202 -------SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASL 259

  Fly   322 WGGLVPRIVMIGTLTA-AQWFIYDAVKVF 349
            |.|..|.:..:|..|. |..|:....|.:
  Fly   260 WKGFTPYLCRLGPHTVFAFIFLEQLTKAY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 24/83 (29%)
Mito_carr <188..258 CDD:278578 14/76 (18%)
Mito_carr 273..350 CDD:278578 23/85 (27%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 66/286 (23%)
Mito_carr 19..90 CDD:278578 22/74 (30%)
Mito_carr 104..201 CDD:278578 19/100 (19%)
Mito_carr 207..284 CDD:278578 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.