DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and PMP34

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:362 Identity:73/362 - (20%)
Similarity:128/362 - (35%) Gaps:120/362 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VAPRQLTR-------NHNIAAAAVAEGDSCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCR 102
            |||.:|::       .|.::.||                    ||.|:..:.:    |||.|:.|
  Fly     2 VAPSKLSQVLSYQNFVHAVSGAA--------------------GGCIAMSTFY----PLDTVRSR 42

  Fly   103 LQVDPA--------KYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLC--KFGLYEVFKKV 157
            ||::.|        ..|.:..|       ||.:.|.:|..|.     :|.||  .|..:..|..:
  Fly    43 LQLEEAGDVRSTRQVIKEIVLG-------EGFQSLYRGLGPV-----LQSLCISNFVYFYTFHAL 95

  Fly   158 YGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPGFA--------------- 207
            ...|.|             .:.:......|:.|..:......:.|||.:.               
  Fly    96 KAVASG-------------GSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSD 147

  Fly   208 ------KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRAD 266
                  |.|.|.|..:..:||:...:.|.:|..| .:....::|..:|.....:.::        
  Fly   148 EVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLM-LVSNPALQFMMYEMLKRNIMRF-------- 203

  Fly   267 CTKGEQLVVT-FAAGYIAGVFCAIVSHPADTVV------SKLNQAKGASA--------------L 310
             |.||...:: |..|.||..|..::::|...|.      ||.:.:|.:::              :
  Fly   204 -TGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMI 267

  Fly   311 DVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFI-YDAV 346
            .:.:..|..||:.||..:|:.. .||||..|: |:.:
  Fly   268 SILQHQGIRGLFRGLEAKILQT-VLTAALMFMAYEKI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 23/98 (23%)
Mito_carr <188..258 CDD:278578 15/90 (17%)
Mito_carr 273..350 CDD:278578 22/96 (23%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 26/116 (22%)
Mito_carr 105..202 CDD:278578 16/97 (16%)
Mito_carr 214..303 CDD:278578 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.