DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG8323

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:308 Identity:78/308 - (25%)
Similarity:122/308 - (39%) Gaps:82/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LGGIISCGSTHTMVVPLDLVKCRLQ-----------VDPAKYKSVFTGFRISLAEEGVRGLAKGW 133
            |||:.|.|:|. ...|::::|.|:|           |:|  ||.:...|......:|:.||.||.
  Fly     8 LGGLASVGATF-FTNPIEVIKTRIQLQGELAARGTYVEP--YKGIVNAFITVAKNDGITGLQKGL 69

  Fly   134 APTFIGYSMQGLCKFGLYEVFKKVYGDAI---------GEENAFLYRTGLYLAASA-------SA 182
            ||..  |....:..|.|     .:|.:|:         ||.:   |..||...|..       |:
  Fly    70 APAL--YFQFIINSFRL-----SIYSEAMERRWMHNRKGEVS---YGMGLLWGAIGGVVGCYFSS 124

  Fly   183 EFFADIALAPMEAAKVKIQTTPGFA---KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMK 244
            .||........:|||   |...|:.   .::.:||.::.::.||...::|.|....|....:..:
  Fly   125 PFFLIKTQLQSQAAK---QIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQ 186

  Fly   245 FACFERTLELLYKY-VVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL-NQ---A 304
            .|.|.:|..||.:| :|.:|..:         :|:||.|||...::...|.|.:.::| ||   |
  Fly   187 IATFGKTKALLVQYDLVTQPTLN---------SFSAGLIAGSIMSVAITPPDVITTRLYNQGVDA 242

  Fly   305 KGASALDVAKQLGW-----------------SGLWGGLVPRIVMIGTL 335
            :|...|    ..||                 .|.|...: ||....||
  Fly   243 EGRGLL----YRGWLDCFVKILRSEGVYGMYKGFWANYL-RIAPHSTL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 26/90 (29%)
Mito_carr <188..258 CDD:278578 17/72 (24%)
Mito_carr 273..350 CDD:278578 22/84 (26%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 25/88 (28%)
PTZ00169 5..293 CDD:240302 78/308 (25%)
Mito_carr 101..200 CDD:278578 26/104 (25%)
Mito_carr 206..301 CDD:278578 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.