DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG8026

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:295 Identity:68/295 - (23%)
Similarity:121/295 - (41%) Gaps:34/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LLCGL-GGIISCGSTHTMVV-PLDLVKCRLQVDPAK------YKSVFTGFRISLAEEGVRGLAKG 132
            |:.|: ||::|     |::: ||||:|.|..|:..:      |:.:.:.|.....:||.|||.||
  Fly    26 LVAGVSGGVVS-----TLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKG 85

  Fly   133 WAPTFIGYSMQGLCKFGLYEVFKKVYGDAI-GEENAFLYRTGLYLAASASAEFFADIALAPMEAA 196
            ..|...|..    ..:|||.:|.......| |..........:.:.|:|.:.....:...|:...
  Fly    86 VTPNVWGSG----SSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVV 146

  Fly   197 KVK--IQTTPGFAKTLR---EALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLY 256
            |.:  :|.....:...|   .||.::..:||:...|:|.|| .|..:.:..::|..:|.......
  Fly   147 KTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVP-GMLGVSHGAIQFMTYEELKNAYN 210

  Fly   257 KYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL--NQAKGASALDVAKQL--- 316
            :|  .|...|........:.|||  ::.:..|..::|...|.::|  :..:.....|..||.   
  Fly   211 EY--RKLPIDTKLATTEYLAFAA--VSKLIAAAATYPYQVVRARLQDHHHRYNGTWDCIKQTWRF 271

  Fly   317 -GWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFL 350
             |:.|.:.||...:..:.......:.:|:.|..||
  Fly   272 EGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 28/91 (31%)
Mito_carr <188..258 CDD:278578 15/74 (20%)
Mito_carr 273..350 CDD:278578 16/82 (20%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 64/274 (23%)
Mito_carr 23..115 CDD:278578 30/97 (31%)
Mito_carr 119..213 CDD:278578 18/96 (19%)
Mito_carr 220..307 CDD:278578 18/89 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.