DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Dic3

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:295 Identity:63/295 - (21%)
Similarity:119/295 - (40%) Gaps:42/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GGI---ISCGSTHTMVVPLDLVKCRLQV-DPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYS 141
            ||:   |:...||    |:||:|.:||. ..|..|:|....:......|:.|...|.:.::....
  Fly    15 GGVCAAIAVTGTH----PIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISASWFRQL 75

  Fly   142 MQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPGF 206
            .....:|.|||.         |::.....:....:|.:..|.....|...|.:...|::|.....
  Fly    76 TYTTTRFALYEA---------GKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKL 131

  Fly   207 AKTLR-------EALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPR 264
            .:..|       :.|.::..:|||::.::|.||...|.:..|:...|.:::..::|        :
  Fly   132 PEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQML--------K 188

  Fly   265 ADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAK-------GASALDVAKQLGWSGLW 322
            .....||.:.:.||...|||....:::.|.|.:.:....|:       |.:.|..||| |....:
  Fly   189 IATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQ-GPLAFY 252

  Fly   323 GGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPP 357
            .|.:|.::.:...|...:.:|:..:  :|....||
  Fly   253 KGFIPALIRVSPNTIITFVLYEQAR--MRFGYLPP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 21/82 (26%)
Mito_carr <188..258 CDD:278578 16/76 (21%)
Mito_carr 273..350 CDD:278578 18/83 (22%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 60/281 (21%)
Mito_carr 15..91 CDD:278578 22/88 (25%)
Mito_carr 93..187 CDD:278578 17/93 (18%)
Mito_carr 200..281 CDD:278578 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.