DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG4995

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:293 Identity:72/293 - (24%)
Similarity:113/293 - (38%) Gaps:62/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LLCGLGGIISCGSTHTMVVPLDLVKCRLQVDP---AKYKSVFTGFRISLAEEGVRGLAKGWAPTF 137
            ||.|..|::       :..|.|.||..||.|.   .|||..|..||..:..:...||.:|.:...
  Fly    48 LLGGAAGVL-------VGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPM 105

  Fly   138 IGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFA--------DIALAPME 194
            .|..:.....||:|...:::..|                ..|.::.|||        ....||||
  Fly   106 GGIGLVNAIVFGVYGNVQRLSND----------------PNSLTSHFFAGSIAGVAQGFVCAPME 154

  Fly   195 AAKVKIQTTPGFAKTLR-----EALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLEL 254
            .||.::|.:......::     ..|..:...||:...:|||....:|.||    .||.:..:.|.
  Fly   155 LAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIP----GFASYFVSFEY 215

  Fly   255 LYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLN-QAKGASA-----LDVA 313
            |.:.|.       |.|  :..|..||..||:...:..:|.|.|.:.:. .|.||:|     :|.|
  Fly   216 LMRQVE-------TPG--VAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCA 271

  Fly   314 ----KQLGWSGLWGGLVPRIVMIGTLTAAQWFI 342
                :..|....:.||...::....:.||.:|:
  Fly   272 MKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 24/86 (28%)
Mito_carr <188..258 CDD:278578 20/74 (27%)
Mito_carr 273..350 CDD:278578 20/80 (25%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 24/83 (29%)
PTZ00169 41..295 CDD:240302 69/282 (24%)
Mito_carr 128..218 CDD:278578 25/109 (23%)
Mito_carr 221..304 CDD:278578 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.