DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Ucp4C

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:308 Identity:77/308 - (25%)
Similarity:131/308 - (42%) Gaps:69/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTG-----FRISLAE----EGVRGLAKGWAP---- 135
            |......:.|.|||:.|.|:|||..:.|.  ||     ||.:|..    ||.:.|..|::.    
  Fly    45 IGANLAESCVFPLDVAKTRMQVDGEQAKK--TGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTR 107

  Fly   136 TFIGYSMQGLCKFGLYEVFKK--VYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKV 198
            .||..|::.:    ||:||::  :|.:...||...:|   :.|..|.:|...|.....|.:..||
  Fly   108 NFIFNSLRVV----LYDVFRRPFLYQNERNEEVLKIY---MALGCSFTAGCIAQALANPFDIVKV 165

  Fly   199 KIQTTP-----GF---AKTLREALPKMTAQEGVTAFYKGLVPLWMRQI--------PYTMMKFAC 247
            ::||..     |:   ..::.:|...:..:.|:.:.:||:.|..||..        .|.:.| ..
  Fly   166 RMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISK-RT 229

  Fly   248 FERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSK-LNQAKGAS--- 308
            |:|.|:|               .|.|.:.|.:...||:..:::|.|||.:.|: :||....|   
  Fly   230 FKRLLDL---------------EEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKN 279

  Fly   309 -----ALDVAKQL----GWSGLWGGLVPRIVMIGTLTAAQWFIYDAVK 347
                 :||..::|    |...|:.||:|....:|..:...|...:.::
  Fly   280 LYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 28/90 (31%)
Mito_carr <188..258 CDD:278578 19/85 (22%)
Mito_carr 273..350 CDD:278578 22/88 (25%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 26/80 (33%)
Mito_carr 137..232 CDD:278578 21/98 (21%)
Mito_carr 237..329 CDD:278578 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.