DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Ant2

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:300 Identity:65/300 - (21%)
Similarity:110/300 - (36%) Gaps:36/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPA--------KYKSVFTGFRISLAEEGVRGLAK 131
            ||:..:.|.:|.....|.|.|::.||..|||...        :||.:...|.....|:|.....:
  Fly    18 FLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWR 82

  Fly   132 GWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAA 196
            |.....|.|.......|...:|:|.|:...:.:...|.......||:..:|...:...:.|::.|
  Fly    83 GNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFA 147

  Fly   197 KVKIQTTPGFA-----KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLY 256
            :.::....|..     ..|.:.|.|:...:|....|:|.:......:.|....|..::...:.| 
  Fly   148 RTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFL- 211

  Fly   257 KYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASA------------ 309
                |.|     |.....|::|...:......|.|:|.|||..::....|...            
  Fly   212 ----PNP-----KSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCW 267

  Fly   310 LDVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVF 349
            |.:|||.|....:.|.:..|:. ||..|....:||.:|.:
  Fly   268 LVIAKQEGIGAFFKGALSNIIR-GTGGALVLALYDEMKKY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 24/92 (26%)
Mito_carr <188..258 CDD:278578 12/74 (16%)
Mito_carr 273..350 CDD:278578 22/88 (25%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 64/297 (22%)
Mito_carr 17..111 CDD:278578 24/92 (26%)
Mito_carr 119..215 CDD:278578 18/105 (17%)
Mito_carr 218..307 CDD:278578 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.