DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG1628

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:292 Identity:79/292 - (27%)
Similarity:121/292 - (41%) Gaps:31/292 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGV-RGLAKGWAPTFI 138
            ||...|||......:.    |||.||.:||..|..|:.:...|..:..::|| |||..|..|...
  Fly   173 FLAGSLGGAAQVYVSQ----PLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVF 233

  Fly   139 GYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTT 203
            ....:....|..|...:|.....:|:|.|....|.....|.:.|..|:.:.|.|.|..|.|:|..
  Fly   234 ANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQAL 298

  Fly   204 PGFAKTLREALPK-----------MTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYK 257
            ......:..|.|:           :...||:..||:||...::|::|.....|..:|.|.|||  
  Fly   299 REMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTRELL-- 361

  Fly   258 YVVPKPRADCTKGEQL--VVTFAAGYIAGVFCAIVSHPADTV-----VSKLNQAKGASALDVAKQ 315
                  |.|....:.:  :.|..||.|.||.....:.|||.:     |..||::..|...|:.::
  Fly   362 ------RRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGADIVRR 420

  Fly   316 LGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVK 347
            .|...|:.||:|.::.....||..:.:|:..|
  Fly   421 EGVLALYRGLLPSVLRTIPATATLFVVYEYTK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 25/85 (29%)
Mito_carr <188..258 CDD:278578 22/80 (28%)
Mito_carr 273..350 CDD:278578 23/82 (28%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 79/292 (27%)
Mito_carr 170..252 CDD:278578 24/82 (29%)
Mito_carr 263..364 CDD:278578 27/108 (25%)
Mito_carr 369..455 CDD:278578 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.