DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG5254

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:215 Identity:62/215 - (28%)
Similarity:93/215 - (43%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 RTGLYLAASASAEFFADIALAPMEAAK--VKIQTTPG-FAKTLRE--------ALPKMTAQEGVT 224
            |....:.|..||.|.....:.|::..|  ::||.||. .|..|.|        ...||...||::
  Fly    13 RAAFQVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGIS 77

  Fly   225 AFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQLVVTFA-AGYIAGVFCA 288
            :::||::|..:.:.|...:||..||:| :.|:::..|.|..         :||: ||..||...|
  Fly    78 SYWKGIMPPILAETPKRAIKFLVFEQT-KPLFQFGSPTPTP---------LTFSLAGLTAGTLEA 132

  Fly   289 IVSHPADTVVSKLNQA----KGASALDVAK------QLGWSGLWGGLVPRIVMIGTLTAAQWFIY 343
            |..:|.: ||....||    |..|...|||      .||:|||..|:...:...|......:..|
  Fly   133 IAVNPFE-VVKVAQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFY 196

  Fly   344 DAVKVFLRMPRPPPPEMPES 363
            .:||..:       ||..||
  Fly   197 HSVKNVV-------PEYKES 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578
Mito_carr <188..258 CDD:278578 23/80 (29%)
Mito_carr 273..350 CDD:278578 28/87 (32%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 27/94 (29%)
PTZ00169 19..301 CDD:240302 61/209 (29%)
Mito_carr 122..207 CDD:278578 28/92 (30%)
Mito_carr 209..305 CDD:278578 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.