DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9143 and Ddx56

DIOPT Version :10

Sequence 1:NP_611467.1 Gene:CG9143 / 37296 FlyBaseID:FBgn0287774 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_523434.2 Gene:Ddx56 / 33118 FlyBaseID:FBgn0001565 Length:560 Species:Drosophila melanogaster


Alignment Length:45 Identity:10/45 - (22%)
Similarity:19/45 - (42%) Gaps:7/45 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 EEEAQKEIDHVLW--EITA-----GKLGEAPATPLANPTKDEPST 195
            :|.:...:.:..|  ::|:     ..||.|..|.:.|..:|...|
  Fly   223 QENSSNRVVNGSWTRDVTSTGFYMKPLGSADNTTIVNIKRDTKHT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9143NP_611467.1 DEADc_DDX24 226..510 CDD:350704
SF2_C_DEAD 521..648 CDD:350174
Ddx56NP_523434.2 DEADc_DDX56 16..221 CDD:350719
SF2_C_DEAD 232..387 CDD:350174 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.