DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10444 and SLC5A3

DIOPT Version :9

Sequence 1:NP_611465.2 Gene:CG10444 / 37294 FlyBaseID:FBgn0034494 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_008864.4 Gene:SLC5A3 / 6526 HGNCID:11038 Length:718 Species:Homo sapiens


Alignment Length:513 Identity:114/513 - (22%)
Similarity:212/513 - (41%) Gaps:93/513 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DAWDAAVLITILVISALIGIYYRYTGGKQKTTQEYLMADQSMTTFPVSFSLMASFMSAISLMGVS 71
            |..|.|::....::...||.:..:...: .|...|.:|.:|||...:..||..|.:.:...:|::
Human     6 DTADIAIVALYFILVMCIGFFAMWKSNR-STVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLA 69

  Fly    72 NESYEFGTIFCVINIAYVLSTPIAAYFFLPVFYRMRTTSVYEYLERRFGQATRLSASLAFTVQMV 136
            ......|..........:|...:..:.|:|::.|....::.|||.:||| ..|:....| .:.::
Human    70 GSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFG-GHRIQVYFA-ALSLI 132

  Fly   137 LY----MGIALYAPALALEAVTGIHRSMAIVVIGLVCTFYSTLGGLKAVLITDVFQSFLMFAAIY 197
            ||    :.:.||:.||.::...|.:..::::::..:....:..|||.||:.||..|:.||.....
Human   133 LYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGAL 197

  Fly   198 AVIAVSAIKAGGFAAI-------------------------WDVAVERGRVNFIEFSLDPTVRHT 237
            .::.:|.::.|||..:                         .:|:.::..:..:....|..|  .
Human   198 TLMIISIMEIGGFEEVKRRYMLASPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDV--P 260

  Fly   238 WWSLIIGGMVTYLSLYGVNQTQVQRLLSVRNLKSAQSALWWNLPILGMLSFSTIFSG-LSIFYYY 301
            |...|:|.....:..:..:|..|||:|:.:|:..|:.              ||:.:| |.:...:
Human   261 WPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKG--------------STLMAGFLKLLPMF 311

  Fly   302 RDCDPLLKGRIDKRDQIM---PLFALETMGQ--------YP---------GLCGLFVSGIFSASL 346
            ....|.:..||...|.|.   |...:...|.        ||         ||.||.::.:.:|.:
Human   312 IIVVPGMISRILFTDDIACINPEHCMLVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALM 376

  Fly   347 STISSAVTSLSAV-TLEDYLKPLYKAIFKRTLIDSKSTMPTKIVACIF--GLLCIGLAFV---AG 405
            |.:.|...|.|.: ||:     :||.|.|     |.|:....||..||  .::.|.:|:|   ..
Human   377 SDLDSIFNSASTIFTLD-----VYKLIRK-----SASSRELMIVGRIFVAFMVVISIAWVPIIVE 431

  Fly   406 SMGGVLQASL-TIFGVVGGPLLAIFTLGVCTTRSNQRGV----LLGFL---VSLIVSF 455
            ..||.:...: .:...:..|:.|:|.|.:...|.|::|.    :.||:   |.||::|
Human   432 MQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10444NP_611465.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 113/511 (22%)
SLC5A3NP_008864.4 SLC5sbd_SMIT 9..718 CDD:271382 113/510 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.