DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10444 and CG34337

DIOPT Version :9

Sequence 1:NP_611465.2 Gene:CG10444 / 37294 FlyBaseID:FBgn0034494 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster


Alignment Length:38 Identity:10/38 - (26%)
Similarity:17/38 - (44%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 MGQ----YPGLCGLFVSGIFSASLSTISSAVTSLSAVT 360
            |||    .|....|...|....|:..::|::.::|..|
  Fly    17 MGQSCLAAPSADDLAKFGEMERSIKELTSSILAMSGAT 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10444NP_611465.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 10/38 (26%)
CG34337NP_001096901.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.