DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS18 and SWS2

DIOPT Version :9

Sequence 1:NP_476964.1 Gene:RpS18 / 37292 FlyBaseID:FBgn0010411 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_014318.3 Gene:SWS2 / 855643 SGDID:S000005025 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:29/136 - (21%)
Similarity:58/136 - (42%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILRIMNTNIDGKRKVGIAMTA-IKGVGRRYSNIVLKKADVDLTKRAGECTEEEVDKVVTIISNPL 75
            ::.|:.....||..:.||:.: ..|:|:..:..:..|.......|..:.:|.::..:.:.:|.. 
Yeast     2 VVHILGKGFKGKEVIKIALASKFYGIGKTTAEKICSKLGFYPWMRMHQLSEPQIMSIASELSTM- 65

  Fly    76 QYKVPNWFLNRQKDIIDGKYWQLTSSNLDSK--LRDDLERLKKIRSHRGLRHYWGLRVRGQHTKT 138
                          .|:|          |::  ::|::...:||.|:.|:||...|.||||||:.
Yeast    66 --------------TIEG----------DARAIVKDNIALKRKIGSYSGMRHTLHLPVRGQHTRN 106

  Fly   139 TGRRGR 144
            ..:..|
Yeast   107 NAKTAR 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS18NP_476964.1 PTZ00134 1..152 CDD:185469 29/136 (21%)
SWS2NP_014318.3 RpsM 2..112 CDD:223177 28/134 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0099
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000788
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100333
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.