DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS18 and RPS18A

DIOPT Version :9

Sequence 1:NP_476964.1 Gene:RpS18 / 37292 FlyBaseID:FBgn0010411 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_010738.1 Gene:RPS18A / 852061 SGDID:S000002858 Length:146 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:99/144 - (68%)
Similarity:122/144 - (84%) Gaps:2/144 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVIPEK--FQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEE 63
            ||||:.|:  ||||||::|||:||..|:..|:|.||||||||||:|.|||||||.|||||.|:||
Yeast     1 MSLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEE 65

  Fly    64 VDKVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRHYWG 128
            ::::|.|:.||..||:|.||||||.||.|||.:...::|::||||||||||||||:|||:||:||
Yeast    66 LERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWG 130

  Fly   129 LRVRGQHTKTTGRR 142
            ||||||||||||||
Yeast   131 LRVRGQHTKTTGRR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS18NP_476964.1 PTZ00134 1..152 CDD:185469 99/144 (69%)
RPS18ANP_010738.1 PTZ00134 1..144 CDD:185469 97/142 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345428
Domainoid 1 1.000 196 1.000 Domainoid score I592
eggNOG 1 0.900 - - E1_COG0099
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88764
Inparanoid 1 1.050 211 1.000 Inparanoid score I805
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62205
OrthoFinder 1 1.000 - - FOG0000788
OrthoInspector 1 1.000 - - otm46898
orthoMCL 1 0.900 - - OOG6_100333
Panther 1 1.100 - - LDO PTHR10871
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1235
SonicParanoid 1 1.000 - - X1076
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.