DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS18 and AT1G77750

DIOPT Version :9

Sequence 1:NP_476964.1 Gene:RpS18 / 37292 FlyBaseID:FBgn0010411 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_177898.1 Gene:AT1G77750 / 844111 AraportID:AT1G77750 Length:154 Species:Arabidopsis thaliana


Alignment Length:142 Identity:33/142 - (23%)
Similarity:66/142 - (46%) Gaps:26/142 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVDKVVTIISNPLQY 77
            :|:.|..:...:.:...:..:.|:|||.|:.||....: ..|.|.:.|.:|:             
plant    32 IRVGNAEVPNNKPLKTGLQEVYGIGRRKSHQVLCHLGI-TNKLARDLTGKEL------------- 82

  Fly    78 KVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRHYWGLRVRGQHTKTTGR- 141
                  ::.::::  |::..  ...|..::..:::||.::..:||.||..||..|||.|.|..| 
plant    83 ------IDLREEV--GQHQH--GDELRRRVGSEIQRLVEVDCYRGSRHRHGLPCRGQRTSTNART 137

  Fly   142 -RGRTVGVSKKK 152
             :|:.|.::.||
plant   138 KKGKAVAIAGKK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS18NP_476964.1 PTZ00134 1..152 CDD:185469 31/140 (22%)
AT1G77750NP_177898.1 Ribosomal_S13 33..150 CDD:412315 33/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0099
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000788
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100333
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.760

Return to query results.
Submit another query.