DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS18 and RPS18C

DIOPT Version :9

Sequence 1:NP_476964.1 Gene:RpS18 / 37292 FlyBaseID:FBgn0010411 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_192718.1 Gene:RPS18C / 826569 AraportID:AT4G09800 Length:152 Species:Arabidopsis thaliana


Alignment Length:152 Identity:109/152 - (71%)
Similarity:134/152 - (88%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVD 65
            ||||..|:||||||::|||:|||:|:..|:|:|||:|||.:|||.||||||:.|||||.:..|:|
plant     1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAEID 65

  Fly    66 KVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRHYWGLR 130
            .::||::||.|:|:|:||||||||..||||.|:.|:.||.|||||||||||||:|||||||||||
plant    66 NLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLR 130

  Fly   131 VRGQHTKTTGRRGRTVGVSKKK 152
            |||||||||||||:|||||||:
plant   131 VRGQHTKTTGRRGKTVGVSKKR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS18NP_476964.1 PTZ00134 1..152 CDD:185469 108/150 (72%)
RPS18CNP_192718.1 PTZ00134 1..152 CDD:185469 108/150 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 201 1.000 Domainoid score I871
eggNOG 1 0.900 - - E1_COG0099
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88764
Inparanoid 1 1.050 236 1.000 Inparanoid score I1110
OMA 1 1.010 - - QHG62205
OrthoDB 1 1.010 - - D1343043at2759
OrthoFinder 1 1.000 - - FOG0000788
OrthoInspector 1 1.000 - - oto3300
orthoMCL 1 0.900 - - OOG6_100333
Panther 1 1.100 - - O PTHR10871
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.