DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS18 and rps18

DIOPT Version :9

Sequence 1:NP_476964.1 Gene:RpS18 / 37292 FlyBaseID:FBgn0010411 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001016358.1 Gene:rps18 / 549112 XenbaseID:XB-GENE-488842 Length:152 Species:Xenopus tropicalis


Alignment Length:152 Identity:119/152 - (78%)
Similarity:143/152 - (94%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVD 65
            ||||||||||||||::||||||:||:..|:||||||||||:::||:|||:||||||||.||:||:
 Frog     1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVE 65

  Fly    66 KVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRHYWGLR 130
            :||||:.||.|||:|:|||||||||.||||.|:.::.||:|||:||||||||::||||||:||||
 Frog    66 RVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIKAHRGLRHFWGLR 130

  Fly   131 VRGQHTKTTGRRGRTVGVSKKK 152
            ||||||||||||||||||||||
 Frog   131 VRGQHTKTTGRRGRTVGVSKKK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS18NP_476964.1 PTZ00134 1..152 CDD:185469 117/150 (78%)
rps18NP_001016358.1 PTZ00134 1..152 CDD:185469 117/150 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 213 1.000 Domainoid score I2701
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H88764
Inparanoid 1 1.050 255 1.000 Inparanoid score I3091
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343043at2759
OrthoFinder 1 1.000 - - FOG0000788
OrthoInspector 1 1.000 - - oto104662
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.