DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS18 and rps1802

DIOPT Version :9

Sequence 1:NP_476964.1 Gene:RpS18 / 37292 FlyBaseID:FBgn0010411 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_588057.2 Gene:rps1802 / 3361064 PomBaseID:SPCC1259.01c Length:152 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:112/152 - (73%)
Similarity:136/152 - (89%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVD 65
            ||||:|:.||||||::|||:|||.||..|||.||||||||:|||.||||:|::|||||.|.||::
pombe     1 MSLVVPDNFQHILRLLNTNVDGKVKVMFAMTQIKGVGRRYANIVCKKADIDMSKRAGELTTEELE 65

  Fly    66 KVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRHYWGLR 130
            ::||||.||.|:|:|:|||||||||.|||.:||.::|:|||||:||||||||::||||||...||
pombe    66 RIVTIIQNPSQFKIPSWFLNRQKDINDGKSFQLLANNVDSKLREDLERLKKIQTHRGLRHALDLR 130

  Fly   131 VRGQHTKTTGRRGRTVGVSKKK 152
            |||||||||||||:||||||||
pombe   131 VRGQHTKTTGRRGKTVGVSKKK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS18NP_476964.1 PTZ00134 1..152 CDD:185469 110/150 (73%)
rps1802NP_588057.2 PTZ00134 1..152 CDD:185469 110/150 (73%)
RpsM 12..152 CDD:223177 102/139 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 197 1.000 Domainoid score I677
eggNOG 1 0.900 - - E1_COG0099
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88764
Inparanoid 1 1.050 237 1.000 Inparanoid score I829
OMA 1 1.010 - - QHG62205
OrthoFinder 1 1.000 - - FOG0000788
OrthoInspector 1 1.000 - - otm47348
orthoMCL 1 0.900 - - OOG6_100333
Panther 1 1.100 - - LDO PTHR10871
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1076
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.