DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS18 and Rps18l1

DIOPT Version :9

Sequence 1:NP_476964.1 Gene:RpS18 / 37292 FlyBaseID:FBgn0010411 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_002727879.1 Gene:Rps18l1 / 100360679 RGDID:2321678 Length:152 Species:Rattus norvegicus


Alignment Length:152 Identity:118/152 - (77%)
Similarity:143/152 - (94%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVD 65
            ||||||||||||||::||||||:||:..|:||||||||||:::||:|||:||||||||.||:||:
  Rat     1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVE 65

  Fly    66 KVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRHYWGLR 130
            :|:||:.||.|||:|:||||||||:.||||.|:.::.||:|||:|||||||||:||||||:||||
  Rat    66 RVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLR 130

  Fly   131 VRGQHTKTTGRRGRTVGVSKKK 152
            ||||||||||||||||||||||
  Rat   131 VRGQHTKTTGRRGRTVGVSKKK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS18NP_476964.1 PTZ00134 1..152 CDD:185469 116/150 (77%)
Rps18l1XP_002727879.1 PTZ00134 1..152 CDD:185469 116/150 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350259
Domainoid 1 1.000 214 1.000 Domainoid score I2648
eggNOG 1 0.900 - - E1_COG0099
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88764
Inparanoid 1 1.050 258 1.000 Inparanoid score I3061
OMA 1 1.010 - - QHG62205
OrthoDB 1 1.010 - - D1343043at2759
OrthoFinder 1 1.000 - - FOG0000788
OrthoInspector 1 1.000 - - otm45947
orthoMCL 1 0.900 - - OOG6_100333
Panther 1 1.100 - - LDO PTHR10871
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.