DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCNA and PCNA2

DIOPT Version :9

Sequence 1:NP_476905.1 Gene:PCNA / 37290 FlyBaseID:FBgn0005655 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_180517.1 Gene:PCNA2 / 817506 AraportID:AT2G29570 Length:264 Species:Arabidopsis thaliana


Alignment Length:259 Identity:160/259 - (61%)
Similarity:217/259 - (83%) Gaps:0/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRN 65
            |.|.||.|.::|||:|:|:|||:|:|.||||.:|..|||||:|||:||||.|||:||:.:|||||
plant     1 MLELRLVQGSLLKKVLEAVKDLVNDANFDCSTTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRN 65

  Fly    66 LSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPE 130
            ||||||||:|:|:||||.|:|.:|:||.|.:||||.||||..|:|::|:|||||::|.||||||:
plant    66 LSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPD 130

  Fly   131 TDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAV 195
            .::..:||||:.||:|||:||:...::|||..||||||||.:||:|||||.|.|..:|||.|:|:
plant   131 AEYHSIVRMPSGEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAI 195

  Fly   196 IIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNE 259
            :|||.|||:|:||.||:|:||||||||..|.:|:.:::|:||||.:.::|:||||||||||:.|
plant   196 VIEMNEPVSLSFALRYMNSFTKATPLSETVTISLSSELPVVVEYKVAEMGYIRYYLAPKIEEEE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCNANP_476905.1 pcna 1..259 CDD:273158 159/257 (62%)
PCNA2NP_180517.1 PLN00057 1..263 CDD:177688 160/259 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 179 1.000 Domainoid score I1059
eggNOG 1 0.900 - - E1_COG0592
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1945
Inparanoid 1 1.050 348 1.000 Inparanoid score I623
OMA 1 1.010 - - QHG62193
OrthoDB 1 1.010 - - D1012066at2759
OrthoFinder 1 1.000 - - FOG0003572
OrthoInspector 1 1.000 - - otm2685
orthoMCL 1 0.900 - - OOG6_100882
Panther 1 1.100 - - O PTHR11352
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.