DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCNA and PCNA

DIOPT Version :9

Sequence 1:NP_476905.1 Gene:PCNA / 37290 FlyBaseID:FBgn0005655 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_002583.1 Gene:PCNA / 5111 HGNCID:8729 Length:261 Species:Homo sapiens


Alignment Length:259 Identity:184/259 - (71%)
Similarity:223/259 - (86%) Gaps:0/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRN 65
            ||||||.|.:||||:|:|:|||:|||.:|.|.||:.||:||:||||||.|||||:|||.:|||||
Human     1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRN 65

  Fly    66 LSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPE 130
            |:||:||.||:||||||.|||.:|::|:|||||:.::||:.|||||||||||||:||.|.|||||
Human    66 LAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPE 130

  Fly   131 TDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAV 195
            .::||||:||:.|||||||||:...::|||.|.|:||||||||::|..||||:||.:||||||||
Human   131 QEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAV 195

  Fly   196 IIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNE 259
            .|||.|||.||||.||||.||||||||:.|.|||.|||||||||.|.|:||::|||||||||.|
Human   196 TIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCNANP_476905.1 pcna 1..259 CDD:273158 183/257 (71%)
PCNANP_002583.1 pcna 1..259 CDD:273158 183/257 (71%)
Interaction with NUDT15. /evidence=ECO:0000269|PubMed:19419956 7..100 63/92 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159145
Domainoid 1 1.000 191 1.000 Domainoid score I3255
eggNOG 1 0.900 - - E1_COG0592
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1945
Inparanoid 1 1.050 379 1.000 Inparanoid score I2077
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62193
OrthoDB 1 1.010 - - D1012066at2759
OrthoFinder 1 1.000 - - FOG0003572
OrthoInspector 1 1.000 - - oto89221
orthoMCL 1 0.900 - - OOG6_100882
Panther 1 1.100 - - LDO PTHR11352
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2713
SonicParanoid 1 1.000 - - X2443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.