DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AT1G68620

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_564936.1 Gene:AT1G68620 / 843192 AraportID:AT1G68620 Length:336 Species:Arabidopsis thaliana


Alignment Length:99 Identity:35/99 - (35%)
Similarity:51/99 - (51%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 ILFHCHGGGFVAQSSK---SHELYLRDWAVALDCPILSVDYSLAPEAPFPRALQEVYYAYCWL-- 453
            ::.:.|||||...|:.   .|| :|...:....|.::||:|.||||.|.|.|.::...|..||  
plant    91 LIVYFHGGGFCVGSASWLCYHE-FLARLSARSRCLVMSVNYRLAPENPLPAAYEDGVNAILWLNK 154

  Fly   454 LNNTELLGTTAE--RVVCAGDSAGANLSIGVALK 485
            ..|..|.....:  |:..||||||.|::..||.:
plant   155 ARNDNLWAKQCDFGRIFLAGDSAGGNIAQQVAAR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906
Aes 350..>537 CDD:223730 35/99 (35%)
Abhydrolase 395..>539 CDD:304388 35/98 (36%)
Abhydrolase <767..827 CDD:304388
AT1G68620NP_564936.1 Abhydrolase_3 92..306 CDD:369561 35/98 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.