DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AT1G49650

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_564550.1 Gene:AT1G49650 / 841389 AraportID:AT1G49650 Length:374 Species:Arabidopsis thaliana


Alignment Length:209 Identity:56/209 - (26%)
Similarity:92/209 - (44%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 AESEMMHKLPSIVG--SSIKVNRLIELPAEPLKL-PRRKNFKASDNLSSDVNQNQGDGDFVEIPV 351
            :.||::.:.|..|.  ...::.||......|..| ||      :|.:|.||..:           
plant    57 SSSEIISEHPPFVRVYKDGRIERLSGTETVPASLNPR------NDVVSKDVVYS----------- 104

  Fly   352 PTAHLGPGLPVSVRLLSARRRSGMLGEGRYRGWHKPIPPSPSILFHCHGGGFVAQS--SKSHELY 414
                  ||..:||||. ...:|..|..|      ..:|    :|.:.|||.::.:|  |..:..:
plant   105 ------PGHNLSVRLF-LPHKSTQLAAG------NKLP----LLIYFHGGAWINESPFSPIYHNF 152

  Fly   415 LRDWAVALDCPILSVDYSLAPEAPFPRALQEVYYAYCWLLNNT------ELLGTTA--ERVVCAG 471
            |.:...:.:|..:||.|..|||.|.|.|.::.:.|..|:.:::      :.:...|  |||..||
plant   153 LTEVVKSANCLAVSVQYRRAPEDPVPAAYEDTWSAIQWIFSHSCGSGEEDWINKYADFERVFLAG 217

  Fly   472 DSAGANLSIGVALK 485
            ||||.|:|..:|::
plant   218 DSAGGNISHHMAMR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 21/88 (24%)
Aes 350..>537 CDD:223730 42/146 (29%)
Abhydrolase 395..>539 CDD:304388 32/101 (32%)
Abhydrolase <767..827 CDD:304388
AT1G49650NP_564550.1 Aes 66..372 CDD:223730 54/200 (27%)
Abhydrolase_3 131..353 CDD:285143 32/101 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.