DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AT1G49640

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_175387.1 Gene:AT1G49640 / 841388 AraportID:AT1G49640 Length:315 Species:Arabidopsis thaliana


Alignment Length:198 Identity:56/198 - (28%)
Similarity:89/198 - (44%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 ESEMM--HKLPSI-VGSSIKVNRLIELPAEPLKLPRRKNFKASDNL-SSDVNQNQGDGDFVEIPV 351
            ||::.  |.||.| :..:.:|.||.....:|..|..:.:..:.|.: |||.|             
plant     2 ESDLTTEHHLPFIRIHKNGRVERLSGNDIKPTSLNPQNDVVSKDVMYSSDHN------------- 53

  Fly   352 PTAHLGPGLPVSVRLLSARRRSGMLGEGRYRGWHKPIPPSPSILFHCHGGGFVAQS--SKSHELY 414
                      :|||:....:...:...|      ..||    :|.:.|||.::.||  |..:..|
plant    54 ----------LSVRMFLPNKSRKLDTAG------NKIP----LLIYFHGGAYIIQSPFSPVYHNY 98

  Fly   415 LRDWAVALDCPILSVDYSLAPEAPFPRALQEVYYAYCWLLNNT-ELLGTTA--ERVVCAGDSAGA 476
            |.:..:..:|..:||.|.||||.|.|.|..:.:.|..|:.::: :.:...|  :||..|||||||
plant    99 LTEVVITANCLAVSVQYRLAPEHPVPAAYDDSWSAIQWIFSHSDDWINEYADFDRVFIAGDSAGA 163

  Fly   477 NLS 479
            |:|
plant   164 NIS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 19/88 (22%)
Aes 350..>537 CDD:223730 40/135 (30%)
Abhydrolase 395..>539 CDD:304388 34/90 (38%)
Abhydrolase <767..827 CDD:304388
AT1G49640NP_175387.1 Aes 11..274 CDD:223730 53/189 (28%)
Abhydrolase_3 77..294 CDD:285143 34/90 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto4212
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.