DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AT1G47480

DIOPT Version :10

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_564507.1 Gene:AT1G47480 / 841155 AraportID:AT1G47480 Length:314 Species:Arabidopsis thaliana


Alignment Length:114 Identity:31/114 - (27%)
Similarity:52/114 - (45%) Gaps:17/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 HKPIPPSPS----ILFHCHGGGFVAQSSK--SHELYLRDWAVALDCPILSVDYSLAPEAPFPRAL 443
            ::|....|.    ::.:.|||.|:..|:.  |:...|.......:...:||:|.||||.|.|.|.
plant    61 YRPFSIQPGQKIPLMLYFHGGAFLISSTSFPSYHTSLNKIVNQANVIAVSVNYRLAPEHPLPTAY 125

  Fly   444 QEVYYAYCWLLNNTELLG-------TTAERVVCAGDSAGANLSIGVALK 485
            ::.:.|    |.|.:.:.       ...:.:...|||||||:|..:|.:
plant   126 EDSWTA----LKNIQAINEPWINDYADLDSLFLVGDSAGANISHHLAFR 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:461882
alpha/beta hydrolases 395..>539 CDD:473884 29/100 (29%)
Aes <767..838 CDD:440422
AT1G47480NP_564507.1 Abhydrolase_3 75..289 CDD:400284 29/100 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.