DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and CXE20

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_201024.1 Gene:CXE20 / 836339 AraportID:AT5G62180 Length:327 Species:Arabidopsis thaliana


Alignment Length:268 Identity:66/268 - (24%)
Similarity:101/268 - (37%) Gaps:74/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 NQGDG----DFVEIPVPTAHLGPG---------LPVSVRLLSARRR----SGMLGEGRYRGWHKP 387
            |..||    |....|...|...|.         |||: :|.|...|    |..:.||.......|
plant    18 NNPDGSITRDLSNFPCTAATPDPSPLNPAVSKDLPVN-QLKSTWLRLYLPSSAVNEGNVSSQKLP 81

  Fly   388 IPPSPSILFHCHGGGFVAQS---SKSHELYLRDWAVALDCPILSVDYSLAPEAPFPRALQEVYYA 449
                  |:.:.|||||:..|   ...|: :..:.|..|:..::|..|.||||...|.|..:...|
plant    82 ------IVVYYHGGGFILCSVDMQLFHD-FCSEVARDLNAIVVSPSYRLAPEHRLPAAYDDGVEA 139

  Fly   450 YCWL-LNNTELLGTTAE--RVVCAGDSAGANLSIGVALKCIEQGVRVPD-------GLFLAY--- 501
            ..|: .::.|.:.:.|:  .|...|.|||.||:..|.|:.::.   |.|       ||.|.:   
plant   140 LDWIKTSDDEWIKSHADFSNVFLMGTSAGGNLAYNVGLRSVDS---VSDLSPLQIRGLILHHPFF 201

  Fly   502 -----------------CPTLVSFVPSPARLLCLMDPLLPFGFMMRCLRAYAAPAQETLQQNAKQ 549
                             ||.:|:.|        :.|..||.|....  ..|:.|   |:...:::
plant   202 GGEERSESEIRLMNDQVCPPIVTDV--------MWDLSLPVGVDRD--HEYSNP---TVGDGSEK 253

  Fly   550 VEDAAQIR 557
            :|...::|
plant   254 LEKIGRLR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 14/52 (27%)
Aes 350..>537 CDD:223730 58/232 (25%)
Abhydrolase 395..>539 CDD:304388 44/176 (25%)
Abhydrolase <767..827 CDD:304388
CXE20NP_201024.1 Abhydrolase_3 83..303 CDD:369561 48/196 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.