DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and GID1C

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_198084.1 Gene:GID1C / 832790 AraportID:AT5G27320 Length:344 Species:Arabidopsis thaliana


Alignment Length:194 Identity:52/194 - (26%)
Similarity:85/194 - (43%) Gaps:24/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 NFKASDNL--SSDVNQNQGDGDFVEIPVPTAHLGPGLPVSVRLLSARRRSGMLGEGRYRGWHKPI 388
            |||.:.||  ..|...|:...:|::..|| |:..|...|....:...|::.:|.. .||......
plant    26 NFKLAYNLLRRPDGTFNRHLAEFLDRKVP-ANANPVNGVFSFDVIIDRQTNLLSR-VYRPADAGT 88

  Fly   389 PPS-------------PSILFHCHGGGFVAQSSKS--HELYLRDWAVALDCPILSVDYSLAPEAP 438
            .||             |.|:|. |||.|...|:.|  ::...|.........::||:|..|||..
plant    89 SPSITDLQNPVDGEIVPVIVFF-HGGSFAHSSANSAIYDTLCRRLVGLCGAVVVSVNYRRAPENR 152

  Fly   439 FPRALQEVYYAYCWLLNNTELLGTTAE---RVVCAGDSAGANLSIGVALKCIEQGVRVPDGLFL 499
            :|.|..:.:....| :|::..|.:..:   |:..||||:|.|:...||::.:|..:.|...:.|
plant   153 YPCAYDDGWAVLKW-VNSSSWLRSKKDSKVRIFLAGDSSGGNIVHNVAVRAVESRIDVLGNILL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 14/51 (27%)
Aes 350..>537 CDD:223730 44/168 (26%)
Abhydrolase 395..>539 CDD:304388 31/110 (28%)
Abhydrolase <767..827 CDD:304388
GID1CNP_198084.1 Abhydrolase_3 107..320 CDD:400284 32/111 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.