DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and CXE18

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_197744.1 Gene:CXE18 / 832418 AraportID:AT5G23530 Length:335 Species:Arabidopsis thaliana


Alignment Length:208 Identity:53/208 - (25%)
Similarity:87/208 - (41%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 PAEPLKLPRRKNFKASDNLSSDVNQNQGDG----------DFVEIPVPTAHLGPGLPVSVRLLSA 369
            |.:.|.||.:.....:...:...|..:.||          ||         ..|..|..|.::|.
plant     7 PNQKLTLPLKTRIALTVISTMTDNAQRPDGTINRRFLRLFDF---------RAPPNPKPVNIVST 62

  Fly   370 RRRSGMLGEGRYRGWHKPIPPS------PSILFHCHGGG--FVAQSSKSHELYLRDWAVALDCPI 426
               |..:.:.....|.:...|.      |.::|. ||||  |::.::..::...|.:|..|...:
plant    63 ---SDFVVDQSRDLWFRLYTPHVSGDKIPVVVFF-HGGGFAFLSPNAYPYDNVCRRFARKLPAYV 123

  Fly   427 LSVDYSLAPEAPFPRALQEVYYAYCWL-LNNTELLGTTAERVVC--AGDSAGANLSIGVALK-CI 487
            :||:|.||||..:|....:.:.|..:: .|:..:|...|:...|  ||||||.|::..||:: | 
plant   124 ISVNYRLAPEHRYPAQYDDGFDALKYIEENHGSILPANADLSRCFFAGDSAGGNIAHNVAIRIC- 187

  Fly   488 EQGVRVPDGLFLA 500
                |.|...|.|
plant   188 ----REPRSSFTA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 14/70 (20%)
Aes 350..>537 CDD:223730 44/163 (27%)
Abhydrolase 395..>539 CDD:304388 36/112 (32%)
Abhydrolase <767..827 CDD:304388
CXE18NP_197744.1 Abhydrolase_3 90..307 CDD:369561 36/113 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.