DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and CXE17

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_197112.1 Gene:CXE17 / 831465 AraportID:AT5G16080 Length:344 Species:Arabidopsis thaliana


Alignment Length:116 Identity:41/116 - (35%)
Similarity:54/116 - (46%) Gaps:17/116 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 SPSI----LFHCHGGGFVAQS---SKSHELYLRDWAVALDCPILSVDYSLAPEAPFPRALQEVYY 448
            |||:    |.:.|||||...|   |..|: :|...||...|.|:||:|.||||...|.|..:...
plant    87 SPSVTLPLLVYFHGGGFCVGSAAWSCYHD-FLTSLAVKARCVIVSVNYRLAPEHRLPAAYDDGVN 150

  Fly   449 AYCWLLNNTELLG---------TTAERVVCAGDSAGANLSIGVALKCIEQG 490
            ...||:......|         .....|..||||||||::..||::.:..|
plant   151 VVSWLVKQQISTGGGYPSWLSKCNLSNVFLAGDSAGANIAYQVAVRIMASG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906
Aes 350..>537 CDD:223730 41/116 (35%)
Abhydrolase 395..>539 CDD:304388 38/108 (35%)
Abhydrolase <767..827 CDD:304388
CXE17NP_197112.1 Aes <76..333 CDD:223730 41/116 (35%)
Abhydrolase_3 95..319 CDD:285143 38/108 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.