DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and CXE16

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_568298.1 Gene:CXE16 / 831281 AraportID:AT5G14310 Length:446 Species:Arabidopsis thaliana


Alignment Length:236 Identity:57/236 - (24%)
Similarity:81/236 - (34%) Gaps:76/236 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 IELPAEPLKLPRRKNFKASDNLS----SDVNQNQGDGDFVEIPVPTAHLGPGLPVSVRLLSARRR 372
            |.||...|. |...:.:..||.:    ||...:.|...  ..|.|          :.|..|.|..
plant    75 IFLPESALS-PEPDSLRHKDNYNHQPRSDRRHSYGPNH--NSPAP----------AERNESRRNS 126

  Fly   373 SGMLGEG--RYRGWHKPIPPSPS---------ILFHCHGGGFVAQSSKS--HELYLRDWAVALDC 424
            .|...|.  .|.|:      :||         ::...||||:|:.||.|  ::.:.|..|...|.
plant   127 YGCNNENLEPYGGY------APSAKRNSRKLPVMLQFHGGGWVSGSSDSAANDFFCRRIAKVCDV 185

  Fly   425 PILSVDYSLAPEAPFPRALQEVYYAYCWL------------LNNTELLGTTAE------------ 465
            .:|:|.|.||||..:|.|.::......||            |.|..:.|...:            
plant   186 IVLAVGYRLAPENRYPAAFEDGVKVLHWLGKQANLADCCKSLGNRRVNGVEVKKLNVQGQIVDAF 250

  Fly   466 ----------------RVVCAGDSAGANLSIGVALKCIEQG 490
                            |.|..|.|.|.|::..||.|.:|.|
plant   251 GASMVEPWLAAHADPSRCVLLGVSCGGNIADYVARKAVEAG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 16/67 (24%)
Aes 350..>537 CDD:223730 47/194 (24%)
Abhydrolase 395..>539 CDD:304388 36/138 (26%)
Abhydrolase <767..827 CDD:304388
CXE16NP_568298.1 Abhydrolase 85..>213 CDD:419691 36/145 (25%)
Abhydrolase_3 154..411 CDD:400284 36/138 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.