DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AT5G06570

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_001330981.1 Gene:AT5G06570 / 830545 AraportID:AT5G06570 Length:344 Species:Arabidopsis thaliana


Alignment Length:167 Identity:48/167 - (28%)
Similarity:65/167 - (38%) Gaps:51/167 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 HKPIPPS-----PSILFHCHGGGFVAQSSKSHELYLRDW----------AVALDCPILSVDYSLA 434
            :|||..|     |.::|. |||||...|        |.|          |.:|:..::|.||.||
plant    80 YKPISASNRTALPVVVFF-HGGGFCFGS--------RSWPHFHNFCLTLASSLNALVVSPDYRLA 135

  Fly   435 PEAPFPRALQEVYYAYCWL--------LNNTELLGTTA--ERVVCAGDSAGANLSIGVALKCIEQ 489
            ||...|.|.::......||        :|:....||..  :||...|||:|.|::..:|      
plant   136 PEHRLPAAFEDAEAVLTWLWDQAVSDGVNHWFEDGTDVDFDRVFVVGDSSGGNIAHQLA------ 194

  Fly   490 GVRVPDGLFLAYCPTLVSFVPSPARLLCLMDPLLPFG 526
             ||...|        .:...|...|...||.|.  ||
plant   195 -VRFGSG--------SIELTPVRVRGYVLMGPF--FG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906
Aes 350..>537 CDD:223730 48/167 (29%)
Abhydrolase 395..>539 CDD:304388 43/152 (28%)
Abhydrolase <767..827 CDD:304388
AT5G06570NP_001330981.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.