DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and GID1B

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_191860.1 Gene:GID1B / 825476 AraportID:AT3G63010 Length:358 Species:Arabidopsis thaliana


Alignment Length:121 Identity:35/121 - (28%)
Similarity:59/121 - (48%) Gaps:8/121 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 KPIPPS---PSILFHCHGGGFVAQSSKS--HELYLRDWAVALDCPILSVDYSLAPEAPFPRALQE 445
            ||:..:   |.::|. |||.|...|:.|  ::.:.|.........::||||..:||..:|.|..:
plant    98 KPLSTTEIVPVLIFF-HGGSFTHSSANSAIYDTFCRRLVTICGVVVVSVDYRRSPEHRYPCAYDD 161

  Fly   446 VYYAYCWLLNNTELLGTTAER--VVCAGDSAGANLSIGVALKCIEQGVRVPDGLFL 499
            .:.|..|:.:...|.......  |..||||:|.|::..||::...:||:|...:.|
plant   162 GWNALNWVKSRVWLQSGKDSNVYVYLAGDSSGGNIAHNVAVRATNEGVKVLGNILL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906
Aes 350..>537 CDD:223730 35/121 (29%)
Abhydrolase 395..>539 CDD:304388 32/109 (29%)
Abhydrolase <767..827 CDD:304388
GID1BNP_191860.1 Abhydrolase_3 109..322 CDD:400284 32/110 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.