DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and CXE13

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_190439.1 Gene:CXE13 / 824031 AraportID:AT3G48700 Length:329 Species:Arabidopsis thaliana


Alignment Length:224 Identity:53/224 - (23%)
Similarity:91/224 - (40%) Gaps:60/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 IVGSSIKVNRLI-ELPAEPLKLPRRKNFKASDNLSSDVNQNQGDGDFVEIPVPTAHLGPGLPVSV 364
            |:..|.::.||: |....|...|:      :..:|.||..:..:...:.|.:|..........||
plant    14 IIYKSGRIERLVGETTVPPSSNPQ------NGVVSKDVVYSPDNNLSLRIYLPEKAATAETEASV 72

  Fly   365 RLLSARRRSGMLGEGRYRGWHKPIPPSPSILFHCHGGGFVAQS--SKSHELYLRDWAVALDCPIL 427
            :|                          .:|.:.|||||:.::  |.::..:|.....|.||..:
plant    73 KL--------------------------PLLVYFHGGGFLVETAFSPTYHTFLTAAVSASDCVAV 111

  Fly   428 SVDYSLAPEAPFPRALQEVYYAYCWLLNNTELLGTTAE----------RVVCAGDSAGANLSIGV 482
            ||||..|||.|.|.:..:.:.|..|:.::  :.|:.:|          :|..||||||||::..:
plant   112 SVDYRRAPEHPIPTSYDDSWTALKWVFSH--IAGSGSEDWLNKHADFSKVFLAGDSAGANITHHM 174

  Fly   483 ALKCI----------EQGVRVPDGLFLAY 501
            .:|..          |.|:   .|:.|.:
plant   175 TMKAAKDKLSPESLNESGI---SGIILVH 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 15/75 (20%)
Aes 350..>537 CDD:223730 42/174 (24%)
Abhydrolase 395..>539 CDD:304388 38/129 (29%)
Abhydrolase <767..827 CDD:304388
CXE13NP_190439.1 Abhydrolase_3 77..305 CDD:400284 38/129 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.