DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AT3G27320

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_189367.1 Gene:AT3G27320 / 822351 AraportID:AT3G27320 Length:460 Species:Arabidopsis thaliana


Alignment Length:368 Identity:78/368 - (21%)
Similarity:120/368 - (32%) Gaps:168/368 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PIVKTTRSLWTSGKYLMNPELRARRIVNISQNAKIDFCKSFWFLAESEMMHKLPSIVGSSIKVNR 310
            |:..:|.:...|||        ||.:.||               |.|:::.:..|: |||   |.
plant    84 PLEPSTSACVYSGK--------ARTLNNI---------------AGSDLLSRRNSL-GSS---NS 121

  Fly   311 LIELPAEPLKLPRRKNFKASDNLSSDVNQNQGDGDFVEIPVPTAHLGPGLPVSVRLLSARRRSGM 375
            |:....|    .||.::..:...||   ...|..|.                             
plant   122 LLSHKVE----SRRNSYGYTTGSSS---PEAGSSDV----------------------------- 150

  Fly   376 LGEGRYRGWHKPIPPSPS--------ILFHCHGGGFVAQSSKS--HELYLRDWAVALDCPILSVD 430
                 |||:    .||.|        ::...||||:|:.|:.|  ::.:.|..|...|..:|:|.
plant   151 -----YRGY----APSSSGGNSRKLPVMLQFHGGGWVSGSNDSVANDFFCRRMAKHCDIIVLAVG 206

  Fly   431 YSLAPEAPFPRALQEVY-----------YAYC--------------------------------- 451
            |.||||..:|.|.::.:           .|.|                                 
plant   207 YRLAPENRYPAACEDGFKVLKWLGKQANLAECNKSMGNSRRPGGEVKKSEVNKHIVDAFGASLVE 271

  Fly   452 -WLLNNTELLGTTAERVVCAGDSAGANLSIGVALKCIEQG-----VRVPDGLFLAYCPTLVSFVP 510
             ||.|:.:     ..|.|..|.|.|||::..||.|.||.|     |:|. ...|.| |..:..||
plant   272 PWLANHAD-----PSRCVLLGVSCGANIADYVARKAIEVGQNLDPVKVV-AQVLMY-PFFIGSVP 329

  Fly   511 SPARL-----------LCLM------------------DPLLP 524
            :.:.:           :|::                  :||:|
plant   330 TQSEIKQANSYFYDKPMCILAWKLFLPEEEFSLDHQAANPLVP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 24/129 (19%)
Aes 350..>537 CDD:223730 54/264 (20%)
Abhydrolase 395..>539 CDD:304388 48/211 (23%)
Abhydrolase <767..827 CDD:304388
AT3G27320NP_189367.1 Abhydrolase_3 169..425 CDD:369561 48/211 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.