DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and GID1A

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_187163.1 Gene:GID1A / 819674 AraportID:AT3G05120 Length:345 Species:Arabidopsis thaliana


Alignment Length:202 Identity:55/202 - (27%)
Similarity:86/202 - (42%) Gaps:38/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 NFKASDNL--SSDVNQNQGDGDFVEIPVPTAHLGPG---------LPVSVRLLSARRRSGMLGEG 379
            |||.:.|:  ..|...|:...::::..| ||:..|.         :...:.|||...|.....:.
plant    26 NFKVAYNILRRPDGTFNRHLAEYLDRKV-TANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQE 89

  Fly   380 RYRGWHKPIPPS-------------PSILFHCHGGGFVAQSSKS--HELYLRDWAVALDCPILSV 429
            :        |||             |.|||. |||.|...|:.|  ::...|.......|.::||
plant    90 Q--------PPSILDLEKPVDGDIVPVILFF-HGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSV 145

  Fly   430 DYSLAPEAPFPRALQEVYYAYCWLLNNTELLGTTAERV--VCAGDSAGANLSIGVALKCIEQGVR 492
            :|..|||.|:|.|..:.:.|..|:.:.:.|......:|  ..||||:|.|::..|||:..|.|:.
plant   146 NYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGID 210

  Fly   493 VPDGLFL 499
            |...:.|
plant   211 VLGNILL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 14/60 (23%)
Aes 350..>537 CDD:223730 49/176 (28%)
Abhydrolase 395..>539 CDD:304388 36/109 (33%)
Abhydrolase <767..827 CDD:304388
GID1ANP_187163.1 Abhydrolase_3 109..322 CDD:400284 37/110 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.