DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AT2G45610

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_182085.1 Gene:AT2G45610 / 819169 AraportID:AT2G45610 Length:324 Species:Arabidopsis thaliana


Alignment Length:205 Identity:49/205 - (23%)
Similarity:77/205 - (37%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 SSDVNQNQGDGDFVEIPVPTAHLGPGLPVSVRLLSARRRSGMLGEGRYRGWHKPIPPSPSILFHC 398
            |.||..|...|..|.|..||     .||.:...::.                  :|    |:.|.
plant    48 SKDVTINHETGVSVRIFRPT-----NLPSNDNAVAR------------------LP----IIIHL 85

  Fly   399 HGGGFV--AQSSKSHELYLRDWAVALDCPILSVDYSLAPEAPFPRALQEVYYAYCWL-------L 454
            ||.|::  ..:|.:::......|..|...::||.|.|.||...|....:...|..|:       .
plant    86 HGSGWILYPANSAANDRCCSQMASELTVIVVSVHYRLPPEHRLPAQYDDALDALLWVKQQVVDST 150

  Fly   455 NNTELLGTTAE--RVVCAGDSAGANLSIGVALKCIEQGVRVP---DGLFLAYCPTLVSFVPSPAR 514
            |....|...|:  |....|.|.|||::..:||:.::..: .|   ||. :.|.|.......:.:.
plant   151 NGEPWLKDYADFSRCYICGSSNGANIAFQLALRSLDHDL-TPLQIDGC-VFYQPLFGGKTRTKSE 213

  Fly   515 LLCLMDPLLP 524
            |....||::|
plant   214 LKNFADPVMP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 11/41 (27%)
Aes 350..>537 CDD:223730 42/189 (22%)
Abhydrolase 395..>539 CDD:304388 36/144 (25%)
Abhydrolase <767..827 CDD:304388
AT2G45610NP_182085.1 Aes 57..323 CDD:223730 45/196 (23%)
Abhydrolase_3 82..303 CDD:285143 36/144 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.