DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AT2G45600

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_566047.1 Gene:AT2G45600 / 819168 AraportID:AT2G45600 Length:329 Species:Arabidopsis thaliana


Alignment Length:242 Identity:61/242 - (25%)
Similarity:85/242 - (35%) Gaps:87/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 KLPRRKNFKASDNLSSDVNQNQGDGDFVEIPVPTAHLGPGLPVSVRLLSARRRSGMLGEGRYRGW 384
            |||..:.       |.|:..||.:..|:.|..|                                
plant    32 KLPPTEQ-------SKDIPLNQTNNTFIRIFKP-------------------------------- 57

  Fly   385 HKPIPPSPS--ILFHCHGGGFVAQSSKS---HELYLRDWAVALDCPILSVDYSLAPEAPFPRALQ 444
             :.|||...  ||.:.|||||:..|:.|   ||...: .|..|...||||:|.||||...|.|.:
plant    58 -RNIPPESKLPILVYFHGGGFILYSAASAPFHESCTK-MADRLQTIILSVEYRLAPEHRLPAAYE 120

  Fly   445 EVYYAYCWLLN-----------NTELL-GTTAERVVCAGDSAGANLSIGVALKCIE--------Q 489
            :...|..||.:           :|.|. |....:....|.|:|.|:...|||:.::        |
plant   121 DAVEAILWLRDQARGPINGGDCDTWLKDGVDFSKCYVMGSSSGGNIVYNVALRVVDTDLSPVKIQ 185

  Fly   490 GVRVPDGLFLAYCPTLVSFVPSPARL----------------LCLMD 520
            |:.:....|....|:     .|.:||                |||.|
plant   186 GLIMNQAFFGGVEPS-----DSESRLKDDKICPLPATHLLWSLCLPD 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 10/55 (18%)
Aes 350..>537 CDD:223730 52/212 (25%)
Abhydrolase 395..>539 CDD:304388 47/165 (28%)
Abhydrolase <767..827 CDD:304388
AT2G45600NP_566047.1 Abhydrolase_3 69..295 CDD:400284 47/165 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.