DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and Afmid

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_001350087.1 Gene:Afmid / 71562 MGIID:2448704 Length:377 Species:Mus musculus


Alignment Length:315 Identity:70/315 - (22%)
Similarity:113/315 - (35%) Gaps:88/315 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 LPAEPLK---LPRRKNFKASDNLSSDVNQNQGDGDFVEIPVPTAHLGPGLPVSVRLLSAR--RRS 373
            ||||...   ||.|:..:.:.||   :..:..|.|              .|.|.....||  ||:
Mouse    19 LPAEATSAEHLPLRRVLQTAQNL---LYLDLTDSD--------------SPASAATQKARATRRN 66

  Fly   374 GM-----LGEGRYRGWHKPIPPS---PSILFHCHGGGFVAQSSKSHELYLRDWAVALDCPILSVD 430
            .:     .|||.....:.|...|   |..|| .| ||:....||....::.:...|....::.|.
Mouse    67 QLDVPYGDGEGEKLDIYFPDEDSKAFPLFLF-LH-GGYWQSGSKDDSAFMVNPLTAQGIVVVIVA 129

  Fly   431 YSLAPEAPFPRALQEVYYAYCWLLNNTELLGTTAERVVCAGDSAGANLSIGVAL-KCIEQGVRVP 494
            |.:||:....:.:.:|..:..:|....    .:.|.:...|.||||:|:..|.| :..:.||   
Mouse   130 YDIAPKGTLDQMVDQVTRSVVFLQRRY----PSNEGIYLCGHSAGAHLAAMVLLARWTKHGV--- 187

  Fly   495 DGLFLAYCPTLVSFVPSPARLLCL----MDPLLPFGFMMRCLRAYAAPAQETLQQNAKQVEDAAQ 555
                   .|.|..|      ||..    ::||:            |....:.|:..   :|||. 
Mouse   188 -------TPNLQGF------LLVSGIYDLEPLI------------ATSQNDPLRMT---LEDAQ- 223

  Fly   556 IRNVPKSNVGSLNSSRRTSMARSPLSPLEASMNPDDESSDTFASASASYHSQTVE 610
             ||.|:.::..:     .:...:|..|:...:...|         |..:|.|:.|
Mouse   224 -RNSPQRHLDVV-----PAQPVAPACPVLVLVGQHD---------SPEFHRQSKE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 17/71 (24%)
Aes 350..>537 CDD:223730 44/201 (22%)
Abhydrolase 395..>539 CDD:304388 33/148 (22%)
Abhydrolase <767..827 CDD:304388
AfmidNP_001350087.1 Aes 5..285 CDD:223730 70/315 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.