DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and Afmid

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:XP_017453019.1 Gene:Afmid / 688283 RGDID:1591143 Length:312 Species:Rattus norvegicus


Alignment Length:373 Identity:71/373 - (19%)
Similarity:119/373 - (31%) Gaps:124/373 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 WFLAESEMMHKLPS------------IVGSSIKVNRLIELPAEPLKLPRRKNFKASDNLSSDVNQ 339
            |....||.:.|..|            :||:.:::.   ....:..:..||...        ||:.
  Rat    14 WRTLSSEELEKQYSPRRWVIRMKTEEVVGNFMQIG---SQATQKARATRRNQL--------DVSY 67

  Fly   340 NQGDGDFVEIPVPTAHLGPGLPVSVRLLSARRRSGMLGEGRYRGWHKPIPPSPSILFHCHGGGFV 404
            ..|.|:.::|..|...                             .|..|     ||....||:.
  Rat    68 GDGVGEKMDIYFPDED-----------------------------SKAFP-----LFMFLHGGYW 98

  Fly   405 AQSSKSHELYLRDWAVALDCPILSVDYSLAPEAPFPRALQEVYYAYCWLLNNTELLGTTAERVVC 469
            ...||....::.:...|....:..|.|.:||:....:.:.:|..:..:|....    .:.|.:..
  Rat    99 QSGSKDDSAFMVNPLTAQGIVVAVVAYDIAPKGTLDQMVDQVSRSVVFLQRRY----PSNEGIYL 159

  Fly   470 AGDSAGANLSIGVAL-KCIEQGVRVPD--GLFLAYCPTLVSFVPSPARLLCLMDPLLPFGFMMRC 531
            .|.||||:|:..:.| ...:.|| .|:  ||.      |||.:..       ::||:        
  Rat   160 CGHSAGAHLAAMMLLASWTKHGV-TPNIQGLL------LVSGIYD-------LEPLV-------- 202

  Fly   532 LRAYAAPAQETLQQNAKQVEDAAQIRNVPKSNVGSLNSSRRTSMARS--PLSPLEASMNPDDESS 594
                 ..:|..|..  ..:|||.  ||.|:..:       ..:.||.  |..|:...:...|   
  Rat   203 -----FTSQNDLLH--MTLEDAE--RNSPQRLL-------EVAPARPVVPAYPVLVFVAQHD--- 248

  Fly   595 DTFASASASYHSQTVERTDLPHTEGDNSSCVSFEDDSQPIVHYPIEIS 642
                  |..:|.|:.|..::|.|           ....|:.|..|.:|
  Rat   249 ------SPEFHRQSKEFCEVPPT-----------TSLAPVQHRVISLS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 15/100 (15%)
Aes 350..>537 CDD:223730 34/189 (18%)
Abhydrolase 395..>539 CDD:304388 31/146 (21%)
Abhydrolase <767..827 CDD:304388
AfmidXP_017453019.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.