DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and Aadacl2fm3

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_001229932.1 Gene:Aadacl2fm3 / 666803 MGIID:3643798 Length:401 Species:Mus musculus


Alignment Length:335 Identity:76/335 - (22%)
Similarity:127/335 - (37%) Gaps:101/335 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 IVGSSIKVNRLIELPAEPLKLPRRKNFKA----SDNLS--SDVNQNQGDGDFVEIPVPTAHLGPG 359
            ::.:.:|::.|:....|.:.|.:.:.|.|    :.|..  ||.|....|.||.:||         
Mouse    35 VIDAGMKISALMGTLLENMGLMKFEEFFAILMEAQNTKPVSDENITVIDTDFSDIP--------- 90

  Fly   360 LPVSVRLLSARRRSGMLGEGRYRGWHKPIPPSPSILFHCHGGGFVAQSSK--SHELYLRDWAVAL 422
                |||...:|:|.              ...|:::| .|||.::..|.|  .::...|..|..|
Mouse    91 ----VRLYLPKRKSE--------------KQRPAVIF-IHGGAYILGSFKMLPYDSVNRWTANKL 136

  Fly   423 DCPILSVDYSLAPEAPFPRALQEVYYAYCWLLNNTEL--LGTTAERVVCAGDSAGANLSIGV--- 482
            |..:::.||.|||:..||.||::..:...:.|.:..|  .|....|:..:|||:|..|:..|   
Mouse   137 DAVVMAPDYRLAPQHLFPAALEDCIFVIKFFLQDKVLAKYGVDPTRICISGDSSGGTLAATVTQL 201

  Fly   483 -------------------ALKCIEQGVRVPDGLFLAYCPTLVSFVPSPARLLCLM---DPLLPF 525
                               ||:.::  ..:|......:.|.|...|  ..||.||.   |..|| 
Mouse   202 LQDDPEYKNKIKAQTLLYPALQALD--TLMPSHREYKHGPFLTRKV--AIRLTCLYLSEDKELP- 261

  Fly   526 GFMMRCLRAYAAPAQETLQQNAKQVEDAAQI-----------RNVPKSNV------GSLNSSRRT 573
                           :|:.:||...:::..:           ....|::|      |:||:| ..
Mouse   262 ---------------KTILRNAHVPQESRHLFKFVNWSDFLPEKYKKNHVYTEPVLGNLNAS-HP 310

  Fly   574 SMARSPLSPL 583
            .:..|..|||
Mouse   311 GLVDSRASPL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 20/80 (25%)
Aes 350..>537 CDD:223730 49/215 (23%)
Abhydrolase 395..>539 CDD:304388 42/172 (24%)
Abhydrolase <767..827 CDD:304388
Aadacl2fm3NP_001229932.1 Aes 68..372 CDD:223730 70/302 (23%)
Abhydrolase_3 107..372 CDD:285143 55/236 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.