DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and AADACL4

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_001013652.1 Gene:AADACL4 / 343066 HGNCID:32038 Length:407 Species:Homo sapiens


Alignment Length:188 Identity:46/188 - (24%)
Similarity:65/188 - (34%) Gaps:38/188 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VSVRLLSARRRSGMLGEGRYRGWHKPIPPSPSILFHCHGGGFVAQSSKSHELYLRDWAVALDCPI 426
            :.|||...:..|..              |...|:|: |||..|..|...:.......|...:..:
Human    97 IPVRLFQPKAASSR--------------PRRGIIFY-HGGATVFGSLDCYHGLCNYLARETESVL 146

  Fly   427 LSVDYSLAPEAPFPRALQEVYYAYCWLLNNTELLGTTAERVVCAGDSAGANLSIGVALKCIEQGV 491
            |.:.|...|:...|...|:...|....|...|..|....|||..|:|.|     |.|:..|.|.:
Human   147 LMIGYRKLPDHHSPALFQDCMNASIHFLKALETYGVDPSRVVVCGESVG-----GAAVAAITQAL 206

  Fly   492 -------RVPDGLFL-----AYCPTLVSFVPSPARLLCLMDPLLPFGFMMRCLRAYAA 537
                   |:...:.:     |:|..|.||..:.      ..|||...||:..|..|.|
Human   207 VGRSDLPRIRAQVLIYPVVQAFCLQLPSFQQNQ------NVPLLSRKFMVTSLCNYLA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 4/13 (31%)
Aes 350..>537 CDD:223730 45/186 (24%)
Abhydrolase 395..>539 CDD:304388 40/155 (26%)
Abhydrolase <767..827 CDD:304388
AADACL4NP_001013652.1 Aes 85..378 CDD:223730 46/188 (24%)
Abhydrolase 115..378 CDD:304388 41/156 (26%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.